PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462929824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 610aa    MW: 66618.4 Da    PI: 4.798
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462929824genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-175193144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++r+
        462929824 51 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERY 93
                     79******************************.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-43858IPR009057Homeodomain-like
SuperFamilySSF466895.51E-193994IPR009057Homeodomain-like
PROSITE profilePS5129423.31646103IPR017930Myb domain
SMARTSM007175.6E-145099IPR001005SANT/Myb domain
PfamPF002492.1E-155193IPR001005SANT/Myb domain
CDDcd001671.76E-145393No hitNo description
Gene3DG3DSA:1.10.10.607.7E-185993IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MTSDKGKVSK KVGEVSGLPQ GCYIVQSGSN LPREKLEKDR WQKVLNPELV KGPWSKEEDE  60
IIVQMVNKYG PKKWSTIAQA LPGRIGKQCR ERYGMEIFFA PNANVALSCD LKVNVDDSNR  120
DAQNSSMCQG MNTDEVPSNS LFSGNQTHYS SANQEMSLVP IDITQEVHLS VIPNVSGAEQ  180
NLHSISNCLE SDLWQGISLQ SLVSGPDTVA ADLQPDMSVS APLVCSDSLS DTPENRPEPR  240
EITDSQAETF PISNNSFGDT EQSVKSGSSD ETSMTMECIT QCGDQRLADA KEPVVSTEKE  300
QSTKDIENNE DEKKDDGALF YKPPKFPSLD DPFVSCDLVP SGDLQDFSPF GMRHLMRSAM  360
DNVPTPLRLW GCPADDENSD GLLAAESFGC TPSVMKKRHR DILSPTPDKR IEKKSGMEKN  420
RGISDSSHKS VATYSKNATP SCKEIISSKS KPAGLIVEKS SPCINASYEY VNILADTPGI  480
KRGLESPSAW KSPLFMQFQG SYLFSPGDRT FDALGLPEHI SVHCATAVAE AHDVLAGGNR  540
NTDEENKENI DAKNEPGTSK LQTKIIAEAR VLDFNECNTP ASTADRKLSS SLGRSVSSPI  600
LSSRNLKIFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-23389345100MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-23389345100MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457080.11e-102hypothetical protein SORBIDRAFT_03g000930
TrEMBLA0A0A9N6M40.0A0A0A9N6M4_ARUDO; Uncharacterized protein
STRINGSb03g000930.11e-102(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-27Homeodomain-like protein